Bacillus subtilis PY79: U712_06920
Help
Entry
U712_06920 CDS
T02937
Name
(GenBank) Putative HMP/thiamine-binding protein ykoF
KO
K24620
energy-coupling factor transport system substrate-specific component
Organism
bsp
Bacillus subtilis PY79
Brite
KEGG Orthology (KO) [BR:
bsp00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bsp02000
]
U712_06920
Transporters [BR:
bsp02000
]
ABC transporters, prokaryotic type
Metallic cation, iron-siderophore and vitamin B12 transporters
Energy-coupling factor transporter
U712_06920
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ykof
Thiamine_BP
Motif
Other DBs
NCBI-ProteinID:
AHA77330
LinkDB
All DBs
Position
complement(1354077..1354679)
Genome browser
AA seq
200 aa
AA seq
DB search
MEHICGTSRIAGFRFSLYPMTDDFISVIKSALKKTDTSKVWTKTDHISTVLRGSIDHVFD
AAKAIYLHAANSEQHIVMNGTFSIGCPGDTQGDTYLSKGDKRVNEDAVRGLKAEAPCQFA
LYPMNEPDYMGLIMEAVDIAKAQGTFVQGVHYASELDGDAHDVFSTLEAVFRMAEQQTNH
ITMTVNLSANSPSRKNRKQG
NT seq
603 nt
NT seq
+upstream
nt +downstream
nt
atggagcatatttgcggtacaagcagaatcgccggttttcgcttctctttatatccgatg
acggatgattttatcagtgtgatcaagtctgcgctgaaaaaaacagatacatccaaggtt
tggacgaaaaccgaccatatcagcacggtgttacgcggatcgattgatcatgtattcgat
gctgcaaaagccatttaccttcatgcagcaaacagcgaacaacacatcgtcatgaacggc
acgttttccattggatgcccgggtgacacacagggggatacatatctttccaaaggtgat
aagcgtgtcaatgaagatgctgtccgaggcttgaaggcggaagcgccgtgccaatttgcc
ctttatccaatgaatgagccggattatatgggattgattatggaggctgtcgacattgca
aaagcccaaggcactttcgtacagggtgtccattacgcgagcgagcttgacggggatgcg
catgacgtattcagcacattggaggccgttttccgcatggctgagcagcaaacaaaccac
atcaccatgactgtgaatctttcggctaacagtccatcaagaaaaaacagaaagcaggga
taa
DBGET
integrated database retrieval system