Betta splendens (Siamese fighting fish): 114842492 Help Entry 114842492         CDS       T08231                                  Name (RefSeq) peptide YY-like   KO K05232   neuropeptide Y Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04080   Neuroactive ligand-receptor interaction bspl04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     114842492  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     114842492  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114842492 Cytokines and neuropeptides [BR:bspl04052]  Neuropeptides   GPCR binding    114842492 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  114842492 NCBI-ProteinID:  XP_028983882 UniProt:  A0A6P7KMU3 LinkDB All DBs Position 16:14286032..14287583 Genome browser AA seq 92 aa AA seqDB search MSLGLLALCLLACIHSGINAYPAKPASPQEGAPPEELAKYYSALRHYINLITRQRYGKRD NPDTLFSDVLLRESTESFPESKYIRYDDLPLW NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcgctgggtcttctggctctctgcctgctggcttgcatccactctggtataaatgcg tatccagccaagcctgccagtccccaggaaggtgcaccgcccgaggagctcgccaaatac tactctgcactaagacactacatcaacctcatcacaagacagaggtatgggaaacgagac aatccagatacgctattttcagacgtgctgctgagggaaagcacagagagttttccagaa tctaaatatatcagatatgatgatctgccgctgtggtga

DBGET integrated database retrieval system