Betta splendens (Siamese fighting fish): 114842870 Help Entry 114842870         CDS       T08231                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03082   ATP-dependent chromatin remodeling bspl04217   Necroptosis Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114842870  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114842870  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bspl03036]     114842870   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114842870 Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114842870 Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114842870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114842870 NCBI-ProteinID:  XP_028984693 UniProt:  A0A6P7KQ67 LinkDB All DBs Position 2:16626897..16628329 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAISRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggcaaagcgggtaaagactctgggaaaaccaagacgaaggctatttcgcgc tcacagagagcaggactgcagttcccagtgggtcgtatccacagacacctcaaatccagg accaccagccacggcagagtgggcgccaccgcagcggtctacagcgcggctattctcgag tatctcaccgccgaggttctggagttggcaggaaatgcatcaaaggatcttaaagtgaag cgtattaccccacgccacttgcagctggccatcagaggagacgaagagctggattcactc atcaaggccactattgctggtggaggtgtgatccctcacatccacaagtctctgattgga aagaagggccagcagaagactgtataa

DBGET integrated database retrieval system