Betta splendens (Siamese fighting fish): 114843193 Help Entry 114843193         CDS       T08231                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04382   Cornified envelope formation bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114843193 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114843193 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114843193 (s100a10b) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of microglial cells    114843193 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_1 p25-alpha Motif Other DBs NCBI-GeneID:  114843193 NCBI-ProteinID:  XP_028985322 UniProt:  A0A6P7KRZ9 LinkDB All DBs Position 16:complement(12919485..12919953) Genome browser AA seq 98 aa AA seqDB search MTELETCMKSLIDIFHRYADSDSDGTSLTKKELKKLCDKELPSFMKAQKNPEIVDRILKD LDNNKDEKLNFEEFLPFICSLMVAADEFCLSRGKKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgaattagagacctgcatgaagtccctgattgacattttccatcgttatgctgat tcagactctgatgggacatctttaaccaagaaagagctgaaaaaattatgtgacaaagag ttgcccagcttcatgaaagcccagaagaaccctgaaatagtggatcgcatcttgaaggat ctggacaacaataaagatgaaaagttgaactttgaagaattccttcccttcatctgcagc ctcatggtggctgctgatgaattctgcctgagccgtgggaagaagggaaaaaagtga

DBGET integrated database retrieval system