Betta splendens (Siamese fighting fish): 114844587 Help Entry 114844587         CDS       T08231                                  Symbol cxcl8a Name (RefSeq) C-X-C motif chemokine 2   KO K10030   interleukin 8 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04060   Cytokine-cytokine receptor interaction bspl04218   Cellular senescence bspl04620   Toll-like receptor signaling pathway bspl04621   NOD-like receptor signaling pathway bspl04622   RIG-I-like receptor signaling pathway bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114844587 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     114844587 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114844587 (cxcl8a)    04621 NOD-like receptor signaling pathway     114844587 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     114844587 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114844587 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114844587 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:bspl00536]     114844587 (cxcl8a) Cytokines and neuropeptides [BR:bspl04052]  Cytokines   Chemokines    114844587 (cxcl8a) Glycosaminoglycan binding proteins [BR:bspl00536]  Heparan sulfate / Heparin   Chemokines    114844587 (cxcl8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  114844587 NCBI-ProteinID:  XP_028988280 UniProt:  A0A6P7L2X4 LinkDB All DBs Position 1:complement(10282172..10284602) Genome browser AA seq 94 aa AA seqDB search MMSSRVIIIAVAVLLASLATNEGMSLGVELHCRCIKTESRRIRFIEKVELIPPNPHCDKL EVIATLRKSGRQVCLDPEALWVKEIIDKITNSTQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgatgagcagcagggtcattatcattgctgtcgcggtgctcctggcgtccctcgccacc aacgaaggaatgagcctgggcgtggagctgcactgccgctgcatcaagacggagagcaga cgcatccggttcatcgagaaggtggagctgatcccgcccaaccctcactgcgacaagctt gaagtcattgccacgctgaggaaatcaggcaggcaggtctgcctcgaccccgaggctctg tgggtgaaggaaataatcgacaaaataacgaacagtacacagtaa

DBGET integrated database retrieval system