Betta splendens (Siamese fighting fish): 114850070 Help Entry 114850070         CDS       T08231                                  Symbol cxcl19 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04060   Cytokine-cytokine receptor interaction bspl04218   Cellular senescence bspl04620   Toll-like receptor signaling pathway bspl04621   NOD-like receptor signaling pathway bspl04622   RIG-I-like receptor signaling pathway bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114850070 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     114850070 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114850070 (cxcl19)    04621 NOD-like receptor signaling pathway     114850070 (cxcl19)    04622 RIG-I-like receptor signaling pathway     114850070 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114850070 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114850070 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:bspl00536]     114850070 (cxcl19) Cytokines and neuropeptides [BR:bspl04052]  Cytokines   Chemokines    114850070 (cxcl19) Glycosaminoglycan binding proteins [BR:bspl00536]  Heparan sulfate / Heparin   Chemokines    114850070 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  114850070 NCBI-ProteinID:  XP_028997864 UniProt:  A0A6P7LVB8 LinkDB All DBs Position 2:complement(21253364..21256016) Genome browser AA seq 101 aa AA seqDB search MKLLILFVLGTLVVVINGLPPINRVHFNNHCRCLHVESRLIPPNSLKSIKLVPKGSHCPE IEVIAGLVSGESICLNPHSSWVKKLVSFVLNEQGKAPKDQA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagctgctcatcctgttcgtgctcgggaccttggttgtcgtcattaatggtctgcca ccaatcaacagggttcacttcaacaaccactgtcggtgtctgcacgtggagtcgaggctc atccctccgaacagtctgaagagcatcaagctcgtccccaaagggtcgcactgcccagag atagaggtcatagctggcctggtgagcggggagagcatctgtctgaaccctcactcctcc tgggtgaaaaagctggtcagctttgtcctgaacgagcaggggaaggcacccaaggaccaa gcctga

DBGET integrated database retrieval system