Betta splendens (Siamese fighting fish): 114851814 Help Entry 114851814         CDS       T08231                                  Symbol calml4a Name (RefSeq) calmodulin-like protein 4a   KO K02183   calmodulin Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04020   Calcium signaling pathway bspl04070   Phosphatidylinositol signaling system bspl04114   Oocyte meiosis bspl04218   Cellular senescence bspl04261   Adrenergic signaling in cardiomyocytes bspl04270   Vascular smooth muscle contraction bspl04371   Apelin signaling pathway bspl04625   C-type lectin receptor signaling pathway bspl04744   Phototransduction bspl04910   Insulin signaling pathway bspl04912   GnRH signaling pathway bspl04916   Melanogenesis Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     114851814 (calml4a)    04020 Calcium signaling pathway     114851814 (calml4a)    04070 Phosphatidylinositol signaling system     114851814 (calml4a)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114851814 (calml4a)    04218 Cellular senescence     114851814 (calml4a)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114851814 (calml4a)   09152 Endocrine system    04910 Insulin signaling pathway     114851814 (calml4a)    04912 GnRH signaling pathway     114851814 (calml4a)    04916 Melanogenesis     114851814 (calml4a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     114851814 (calml4a)    04270 Vascular smooth muscle contraction     114851814 (calml4a)   09157 Sensory system    04744 Phototransduction     114851814 (calml4a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bspl01009]     114851814 (calml4a)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bspl04131]     114851814 (calml4a)    03036 Chromosome and associated proteins [BR:bspl03036]     114851814 (calml4a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114851814 (calml4a) Protein phosphatases and associated proteins [BR:bspl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114851814 (calml4a) Membrane trafficking [BR:bspl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114851814 (calml4a) Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114851814 (calml4a) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114851814 (calml4a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EAP30 DUF2666 FlgD EF-hand_11 DUF5580_M EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  114851814 NCBI-ProteinID:  XP_028999413 UniProt:  A0A6P7LZT0 LinkDB All DBs Position 3:2362673..2364281 Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEIKECFSLYDKKRKGKIDARDLITVMRCLGTSPTLGEIERHLQVHKIEK TGELDFSTFLTMMHRQMQQEDPKTEILEALRMTDKQKKGYIQASELRAKLTKLGEKLTDK EVDDLFREANIRSNGIINYEEFTQMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcttcacaccagttcagatcaatgagatcaaggagtgtttctccttgtat gataagaagcgaaagggcaagatcgatgccagagacctgatcacggtcatgcgctgtctg gggacgagccccacgctcggcgaaattgaaagacatctacaagttcacaaaatcgagaag acgggcgagctcgacttctccacgttcctgacgatgatgcacagacaaatgcaacaggag gaccccaagacagaaatcctggaggccttgaggatgacggacaaacagaagaaggggtac attcaggcgtcggagctgcgggcaaagctcaccaagctcggggagaaactcacagacaaa gaggtggacgatctcttcagagaggcgaacatcaggtccaacgggatcatcaactacgaa gagttcacccagatggtgacgctgccgcccgtggattattag

DBGET integrated database retrieval system