Betta splendens (Siamese fighting fish): 114852065 Help Entry 114852065         CDS       T08231                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03030   DNA replication bspl03082   ATP-dependent chromatin remodeling bspl03410   Base excision repair bspl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     114852065 (pole3)    03410 Base excision repair     114852065 (pole3)    03420 Nucleotide excision repair     114852065 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114852065 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bspl03032]     114852065 (pole3)    03036 Chromosome and associated proteins [BR:bspl03036]     114852065 (pole3)    03400 DNA repair and recombination proteins [BR:bspl03400]     114852065 (pole3) Enzymes [BR:bspl01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      114852065 (pole3) DNA replication proteins [BR:bspl03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     114852065 (pole3) Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     114852065 (pole3) DNA repair and recombination proteins [BR:bspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       114852065 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP SpoU_methylase DUF5427 DUF4746 RNA_pol_3_Rpc31 Afi1 Motif Other DBs NCBI-GeneID:  114852065 NCBI-ProteinID:  XP_028999947 UniProt:  A0A6P7M161 LinkDB All DBs Position 3:complement(3349391..3351575) Genome browser AA seq 148 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDKEKKAGSDNDK SREEEEEDDHMEEEEPPEEEAEEEEVEN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagagaggccggaggacctgaaccttcccaacgcggtcatcactcgcataatcaaa gaggcgctcccagatggggtgaatgtgtccaaagaagcaaggagagccatatcccaagct gccagtgtgtttgtgttgtatgcaacatcttgtgcaaataattttgccatgaaagccaag agaaaaactttgaatgcaggcgatgttttggccgcgatggaggagatggagtttgaaaga ttcctggagcctcttagagaagctttggaagtgtataaaaaggggcaaaaggggaagaag gaggtgtctgagcagaagcgcaaagataaagagaagaaggccggctctgacaatgataag agcagggaggaagaggaggaggatgaccacatggaggaagaggagccacctgaggaggag gctgaagaggaggaagtagagaattga

DBGET integrated database retrieval system