Betta splendens (Siamese fighting fish): 114854697 Help Entry 114854697         CDS       T08231                                  Symbol smx5 Name (RefSeq) smx5   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03018   RNA degradation bspl03040   Spliceosome Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     114854697 (smx5)   09123 Folding, sorting and degradation    03018 RNA degradation     114854697 (smx5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bspl03019]     114854697 (smx5)    03041 Spliceosome [BR:bspl03041]     114854697 (smx5) Messenger RNA biogenesis [BR:bspl03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      114854697 (smx5)   mRNA degradation factors    5'-3' decay     Lsm complex      114854697 (smx5) Spliceosome [BR:bspl03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     114854697 (smx5)  Complex C   U2 snRNP components     114854697 (smx5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DYW_deaminase Motif Other DBs NCBI-GeneID:  114854697 NCBI-ProteinID:  XP_029005148 UniProt:  A0A6P7MFP8 LinkDB All DBs Position 4:complement(29028629..29030301) Genome browser AA seq 95 aa AA seqDB search MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC FIRGSVVRYVQLPADEVDTQLLQDAARKEAMQQKQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcttttctactcgtttttcaaatcactagtggggaaggacgtggtggtggagctcaaa aacgacctgagcatttgtggaactcttcattctgttgaccagtaccttaacattaagctc acagacatcagtgtgacagatccagagaaatacccacacatgctgtcagtaaaaaactgt ttcatccgcggatctgtggttcggtatgttcagttacctgcagatgaagtggacactcag ctgctacaagatgctgcacgaaaggaagcgatgcagcagaagcagtga

DBGET integrated database retrieval system