Betta splendens (Siamese fighting fish): 114855901 Help Entry 114855901         CDS       T08231                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04137   Mitophagy - animal bspl04140   Autophagy - animal bspl04144   Endocytosis bspl04145   Phagosome bspl04148   Efferocytosis bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114855901    04145 Phagosome     114855901    04140 Autophagy - animal     114855901    04137 Mitophagy - animal     114855901    04148 Efferocytosis     114855901  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114855901  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bspl04131]     114855901   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114855901    04031 GTP-binding proteins [BR:bspl04031]     114855901 Membrane trafficking [BR:bspl04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     114855901 Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114855901   Exosomal proteins of other body fluids (saliva and urine)    114855901   Exosomal proteins of colorectal cancer cells    114855901   Exosomal proteins of bladder cancer cells    114855901 GTP-binding proteins [BR:bspl04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     114855901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  114855901 NCBI-ProteinID:  XP_029007261 UniProt:  A0A6P7MKF5 LinkDB All DBs Position 5:10305820..10311832 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttccaggaagaaagtgctgttgaaagtcatcatcttgggagattctggtgttggg aaaacctctctaatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcggacttcttgaccaaggaggtgatggtggatgaccggcttgttacaatgcag atatgggacacagctggccaagagaggtttcagtcattgggtgttgcattttaccgtgga gcagactgctgtgtactagtgtttgatgtgactgcccccaataccttcaagacacttgac agctggagggatgagtttctgatccaggcgagcccccgagatcctgaaaacttccccttt gtggttctaggcaacaagattgacttagagaatagacaggtaaccaccaaaagggcgcag gcatggtgtcagagtaagaacaacatcccctactttgagaccagtgcaaaagaagccatt aatgtagagcaggcattccagacaattgcacgaaacgccctcaaacaggaaacagaggta gagctgtacaacgaattcccagagcccattaaactggataggaacgacagagctaaagct tcagctgaaagctgcagctgctga

DBGET integrated database retrieval system