Betta splendens (Siamese fighting fish): 114856923 Help Entry 114856923         CDS       T08231                                  Symbol cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism bspl  Betta splendens (Siamese fighting fish) Brite KEGG Orthology (KO) [BR:bspl00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114856923 (cd59)    04090 CD molecules [BR:bspl04090]     114856923 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bspl00537]     114856923 (cd59) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114856923 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    114856923 (cd59)   Exosomal proteins of colorectal cancer cells    114856923 (cd59) CD molecules [BR:bspl04090]  Proteins   114856923 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bspl00537]  Antigens   114856923 (cd59) SSDB OrthologParalogGFIT Motif Pfam:  CD59 UPAR_LY6 Toxin_TOLIP Acyl-CoA_dh_C Motif Other DBs NCBI-GeneID:  114856923 NCBI-ProteinID:  XP_029008649 UniProt:  A0A6P7MS98 LinkDB All DBs Position 6 Genome browser AA seq 117 aa AA seqDB search MKHCLGLFLLVCCGLLRLGSGLSCYKCADYTGVCENVQPCTDEDACISLSERDGKTVRQC IRYTDCNFSRLAQMFPSFAQFTYRCCTTNLCNSGHAVAKATPPLTLVGLLLCVWSWM NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaagcactgcctcggactcttcctgctggtctgttgtgggctgctgcgcctgggttct ggactgagctgctacaagtgtgctgattacaccggagtctgtgagaacgtccagccgtgc acagacgaagacgcctgcatttctctgagtgaacgagatgggaaaaccgtccgtcagtgt atcaggtacacagactgcaacttctctcgcctcgcccagatgttcccgtcattcgcacag ttcacctaccgttgctgcaccaccaacctctgcaactctggccacgcggttgccaaggca acgccccccctcaccctggtggggttgctgctctgcgtttggtcctggatgtga

DBGET integrated database retrieval system