Betta splendens (Siamese fighting fish): 114857896 Help Entry 114857896         CDS       T08231                                  Symbol ppp3r1b Name (RefSeq) calcineurin subunit B type 1b   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04020   Calcium signaling pathway bspl04114   Oocyte meiosis bspl04218   Cellular senescence bspl04310   Wnt signaling pathway bspl04370   VEGF signaling pathway bspl04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114857896 (ppp3r1b)    04310 Wnt signaling pathway     114857896 (ppp3r1b)    04370 VEGF signaling pathway     114857896 (ppp3r1b)    04020 Calcium signaling pathway     114857896 (ppp3r1b)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114857896 (ppp3r1b)    04218 Cellular senescence     114857896 (ppp3r1b)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114857896 (ppp3r1b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bspl01009]     114857896 (ppp3r1b) Protein phosphatases and associated proteins [BR:bspl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114857896 (ppp3r1b) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg Allatotropin-like_C EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  114857896 NCBI-ProteinID:  XP_029010648 UniProt:  A0A6P7MWC9 LinkDB All DBs Position 1 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFRKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFQEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGFISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaagccagttaccccctggaaatgtgctcacacttcgatgctgatgagatt aagaggctgggaaagagattcaggaaactggacctggataactcgggttccctgagcgtg gaggagttcatgtcgttgccagagctccagcagaatcctctcgtgcagcgagttatcgac atatttgacaccgacggaaacggagaggtcgacttccaagagttcattgaaggtgtctcc cagttcagtgttaaaggtgacaaggagcagaagttgcgcttcgctttcaggatctacgac atggacaaagacggcttcatctccaacggcgagctcttccaggtcctgaagatgatggtg ggcaacaacctgaaggacacccagcttcagcagatcgtcgacaaaaccattatcaacgca gacaaagacggagatggaaggatatcgtttgaggagttttgcgcagtcgtaggtgggtta gacattcacaagaagatggtggtggacgtctga

DBGET integrated database retrieval system