Betta splendens (Siamese fighting fish): 114857963 Help Entry 114857963         CDS       T08231                                  Symbol dpy30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism bspl  Betta splendens (Siamese fighting fish) Brite KEGG Orthology (KO) [BR:bspl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bspl03036]     114857963 (dpy30) Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      114857963 (dpy30)     MLL-HCF complex      114857963 (dpy30)     MLL3/MLL4 complex      114857963 (dpy30) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  114857963 NCBI-ProteinID:  XP_029010763 UniProt:  A0A6P7MWP4 LinkDB All DBs Position 1:575622..577410 Genome browser AA seq 104 aa AA seqDB search MADDHTDAEQSMEGHTPVSENPHAEYSLTENIQRTAENEKASAEKISKQKVDLQALPTRA YLDQTVVPILLQGLSVLAKERPPNPIEYLAAFLLKNKSQFEDRN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcagacgatcacacagatgcagagcagtcgatggagggacacacacctgtgtctgaa aacccgcatgcagagtacagcctgactgaaaacatccagaggacggcggagaacgaaaag gcgagtgcagagaagatctcgaagcagaaggtggatctacaggcgctgccgaccagagcg tacctggaccagacggtggtcccaatcctgctgcagggcctttcggtgctcgccaaggag agaccacccaaccctatagagtacctggcggctttcctgcttaagaacaaatcccagttt gaggacagaaattag

DBGET integrated database retrieval system