Betta splendens (Siamese fighting fish): 114858205 Help Entry 114858205         CDS       T08231                                  Symbol fkbp1ab Name (RefSeq) FKBP prolyl isomerase 1Ab   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism bspl  Betta splendens (Siamese fighting fish) Brite KEGG Orthology (KO) [BR:bspl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bspl03110]     114858205 (fkbp1ab) Enzymes [BR:bspl01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      114858205 (fkbp1ab) Chaperones and folding catalysts [BR:bspl03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     114858205 (fkbp1ab) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  114858205 NCBI-ProteinID:  XP_029010958 UniProt:  A0A6P7MXA6 LinkDB All DBs Position 7:13694550..13699267 Genome browser AA seq 108 aa AA seqDB search MGVEIETITPGDGRTFPKKGQTCVVHYVGSLTDGRKFDSSRDRDKPFRFKIGKQEVIRGW EEGVVQMSVGQRAKLTCSPEYAYGIKGHPGIIPPNATLVFDVELLGLE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgggagtggaaatcgagaccataaccccgggcgacggaaggactttccccaaaaaagga cagacgtgcgtggtgcattacgtgggctccctgacagatggacgcaagttcgactcctcc cgagacagagacaagccgttcaggttcaagatcgggaagcaggaagtgatccggggctgg gaggagggtgtggtgcagatgagtgtgggtcaacgagccaaactgacttgctctcctgaa tatgcttatggaatcaaaggccaccccggcatcatcccccccaacgccaccctcgtcttc gacgtagagctgctgggtttggaatga

DBGET integrated database retrieval system