Betta splendens (Siamese fighting fish): 114859989 Help Entry 114859989         CDS       T08231                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114859989 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bspl04121]     114859989 (elob)    03400 DNA repair and recombination proteins [BR:bspl03400]     114859989 (elob) Ubiquitin system [BR:bspl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114859989 (elob)    Cul5 complex      114859989 (elob) DNA repair and recombination proteins [BR:bspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114859989 (elob) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114859989 NCBI-ProteinID:  XP_029014002 UniProt:  A0A6P7N3U3 LinkDB All DBs Position 8 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDVLLNDSQSLGNC GFTNQTARPQAPAMVGLAFRLSDDSFEQLRIEPFSTPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgatcagacgtcacaagacgaccatcttcacagatgccaaagag tctacaacggtatatgagctgaagcgcattgtggaaggcattttaaaaaggccacctgaa gatcagaggctttataaggatgatgttttgcttaatgactcccaatctcttggtaattgc ggctttacaaatcaaacagcccgacctcaggcaccagccatggtgggattagctttccgt ctgagtgatgattcatttgagcagctgaggattgagcccttctccactccgccagagctc ccagatgtcatgaagccccaggattcaggaagtacagccaatgagcaggctgtacagtga

DBGET integrated database retrieval system