Betta splendens (Siamese fighting fish): 114860397 Help Entry 114860397         CDS       T08231                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04137   Mitophagy - animal bspl04140   Autophagy - animal bspl04218   Cellular senescence bspl04371   Apelin signaling pathway bspl04625   C-type lectin receptor signaling pathway bspl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114860397 (rras)    04371 Apelin signaling pathway     114860397 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114860397 (rras)    04137 Mitophagy - animal     114860397 (rras)   09143 Cell growth and death    04218 Cellular senescence     114860397 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114860397 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114860397 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114860397 (rras)    04031 GTP-binding proteins [BR:bspl04031]     114860397 (rras) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114860397 (rras)   Exosomal proteins of bladder cancer cells    114860397 (rras) GTP-binding proteins [BR:bspl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114860397 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  114860397 NCBI-ProteinID:  XP_029014793 UniProt:  A0A6P7N8Y1 LinkDB All DBs Position 8:9898286..9903785 Genome browser AA seq 197 aa AA seqDB search MSGDEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKMCIVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLMVFALNDLGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEAQRAITREEGQAFARENRIHYMEASAKNRYNVDEAFLEVVRIIRRFQEMESPPPP THQTRKQKNSGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcggagacgaggaaagatacaagctggtggtggtgggaggaggaggggtcggaaag agcgccctgaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatt gaagactcctacaccaagatgtgcatcgtggacgggaaggagactcggctggacatcttg gatacagcaggtcaggaggaatttggggcaatgagggagcagtacatgcgctcaggagaa ggctttttgatggtgttcgcgctcaacgacctgggcagctaccacgaggtccagaagttc cacacccagatcttgagagtaaaggatcgagatgacttcccgatggtgctggtggggaac aaagctgacctggaggcgcaaagagcgatcaccagggaggaaggtcaggcgtttgccaga gagaacaggatccactatatggaggcgtcggccaaaaaccgttacaatgtggatgaggcc ttcctggaggtagtgcgaattatcaggcgatttcaggagatggaaagtcctcctcctccg actcaccagacaagaaaacagaagaatagcggctgcccttgtgtgctcctctaa

DBGET integrated database retrieval system