Betta splendens (Siamese fighting fish): 114860397 Help Entry 114860397         CDS       T08231                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04137   Mitophagy - animal bspl04140   Autophagy - animal bspl04218   Cellular senescence bspl04371   Apelin signaling pathway bspl04519   Cadherin signaling bspl04625   C-type lectin receptor signaling pathway bspl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114860397 (rras)    04371 Apelin signaling pathway     114860397 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     114860397 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114860397 (rras)    04137 Mitophagy - animal     114860397 (rras)   09143 Cell growth and death    04218 Cellular senescence     114860397 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114860397 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114860397 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114860397 (rras)    04031 GTP-binding proteins [BR:bspl04031]     114860397 (rras) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114860397 (rras)   Exosomal proteins of bladder cancer cells    114860397 (rras) GTP-binding proteins [BR:bspl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114860397 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  114860397 NCBI-ProteinID:  XP_029014793 UniProt:  A0A6P7N8Y1 LinkDB All DBs Position 8:9898286..9903785 Genome browser AA seq 197 aa AA seqDB search MSGDEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKMCIVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLMVFALNDLGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEAQRAITREEGQAFARENRIHYMEASAKNRYNVDEAFLEVVRIIRRFQEMESPPPP THQTRKQKNSGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcggagacgaggaaagatacaagctggtggtggtgggaggaggaggggtcggaaag agcgccctgaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatt gaagactcctacaccaagatgtgcatcgtggacgggaaggagactcggctggacatcttg gatacagcaggtcaggaggaatttggggcaatgagggagcagtacatgcgctcaggagaa ggctttttgatggtgttcgcgctcaacgacctgggcagctaccacgaggtccagaagttc cacacccagatcttgagagtaaaggatcgagatgacttcccgatggtgctggtggggaac aaagctgacctggaggcgcaaagagcgatcaccagggaggaaggtcaggcgtttgccaga gagaacaggatccactatatggaggcgtcggccaaaaaccgttacaatgtggatgaggcc ttcctggaggtagtgcgaattatcaggcgatttcaggagatggaaagtcctcctcctccg actcaccagacaagaaaacagaagaatagcggctgcccttgtgtgctcctctaa

DBGET integrated database retrieval system