Betta splendens (Siamese fighting fish): 114863118 Help Entry 114863118         CDS       T08231                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl03082   ATP-dependent chromatin remodeling bspl04217   Necroptosis Brite KEGG Orthology (KO) [BR:bspl00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114863118  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114863118  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bspl03036]     114863118   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114863118 Chromosome and associated proteins [BR:bspl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114863118 Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114863118 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114863118 NCBI-ProteinID:  XP_055367803 UniProt:  A0A6P7NIW2 LinkDB All DBs Position 9:5959170..5962365 Genome browser AA seq 129 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAGKAK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggaagaggaaaaaccgggggcaaagccagagctaaggctaaaacccgctcctcc agagctggactccagttccccgtgggtcgtgtccacaggctgctgcgtaaaggaaactat gcggagcgcgtcggtgccggagctcctgtctacttggcggctgttctagagtatctgacc gctgagatcctggagttggctggaaacgctgcccgcgacaacaagaagaccaggatcatc ccccgccacctgcagctggctgtccgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgcccagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag acggagaaacccgccggcaaagcaaagtag

DBGET integrated database retrieval system