Betta splendens (Siamese fighting fish): 114864486 Help Entry 114864486         CDS       T08231                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04068   FoxO signaling pathway bspl04081   Hormone signaling bspl04114   Oocyte meiosis bspl04140   Autophagy - animal bspl04150   mTOR signaling pathway bspl04810   Regulation of actin cytoskeleton bspl04910   Insulin signaling pathway bspl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114864486 (insb)    04068 FoxO signaling pathway     114864486 (insb)    04150 mTOR signaling pathway     114864486 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     114864486 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114864486 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     114864486 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114864486 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     114864486 (insb)    04914 Progesterone-mediated oocyte maturation     114864486 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114864486 (insb) Cytokines and neuropeptides [BR:bspl04052]  Neuropeptides   Unclassified    114864486 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  114864486 NCBI-ProteinID:  XP_029021182 UniProt:  A0A6P7NMV8 LinkDB All DBs Position 10:7761710..7763042 Genome browser AA seq 113 aa AA seqDB search MARVPWVVSMLLLLIVSSQEVSMTPVQYLCGSHLVDTLYFVCGERGFFYSPNRPHKRDVE QLLGFLSKRARQEQQQQQWGASSGHEEAKVKRGIVEQCCHKPCSIYHLESYCD NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgggtggtgtctatgctgctgctgctcatcgtcagctcccaggag gtgtccatgacccctgtccagtacctctgtggctcccacctggtggacaccctctacttc gtctgtggggaacggggcttcttctacagcccaaaccgaccccacaagcgcgacgtggag caactgctcgggttcctgtctaaaagggccaggcaggagcagcagcagcagcagtggggg gcttcatctggacacgaggaggccaaggtgaagagaggcatcgtggagcagtgctgccat aagccatgcagcatttaccacctagaaagctactgcgactga

DBGET integrated database retrieval system