Betta splendens (Siamese fighting fish): 114864489 Help Entry 114864489         CDS       T08231                                  Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04068   FoxO signaling pathway bspl04081   Hormone signaling bspl04114   Oocyte meiosis bspl04115   p53 signaling pathway bspl04150   mTOR signaling pathway bspl04510   Focal adhesion bspl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114864489    04068 FoxO signaling pathway     114864489    04150 mTOR signaling pathway     114864489   09133 Signaling molecules and interaction    04081 Hormone signaling     114864489  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114864489    04115 p53 signaling pathway     114864489   09144 Cellular community - eukaryotes    04510 Focal adhesion     114864489  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     114864489  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114864489 Cytokines and neuropeptides [BR:bspl04052]  Cytokines   Growth factors (RTK binding)    114864489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  114864489 NCBI-ProteinID:  XP_040928665 UniProt:  A0A8M1HJK5 LinkDB All DBs Position 10:1779715..1781815 Genome browser AA seq 166 aa AA seqDB search PDFEFSAPLQALCARVCVFYYTVLLASWPLSADAARLRCGSDLLSDLIFVCGDRGIYLGR GKWSGYGARPRGEGIVDQCCRPAGCELHHLEMYCAKPKSQQQTTALPTTTAAATQTDEDL QFQAVFYRRLLEHMGPPDSAKREASRKKAQPPHPRKPHAGALEHRT NT seq 501 nt NT seq  +upstreamnt  +downstreamnt cctgactttgagttctctgctcctcttcaggcgttgtgtgctcgcgtgtgcgtgttctac tacaccgtacttctagccagctggccgctctccgcggacgcagccaggctccgctgtggc tcggatcttctcagcgacctcatattcgtgtgtggggaccgtggcatctatttgggtaga gggaaatggtctggctacggggctcggcccagaggggaggggatcgtggaccagtgctgt cgtccagccggctgtgagctccaccatctggagatgtactgcgctaaacccaagagccag cagcaaaccacagctttgcccacaacaacagcagcagcaacgcagacagatgaggatctg caattccaagcagttttttacaggagacttctggagcacatggggcccccagacagcgca aagagggaagcctccaggaagaaggctcagcctccccacccaagaaagcctcacgccgga gcattagagcacagaacatga

DBGET integrated database retrieval system