Betta splendens (Siamese fighting fish): 114865494 Help Entry 114865494         CDS       T08231                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04382   Cornified envelope formation bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114865494 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114865494 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114865494 (s100a10a) Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of microglial cells    114865494 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH Astro_p19 DEK_C SPARC_Ca_bdg Baculo_p74_N Motif Other DBs NCBI-GeneID:  114865494 NCBI-ProteinID:  XP_029022492 UniProt:  A0A6P7NRG0 LinkDB All DBs Position 11:11613418..11614798 Genome browser AA seq 99 aa AA seqDB search MPSELENAMQSLITVFHSYAGKDGKNTLSRRELRELMEHELPNFLKSQKDPAAVDKIMRD LDANGDGQVDFEEFVALVVGLSIACEQCYQAHLKKYAKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaaacgccatgcagtcactcatcacggtgttccactcgtacgcc ggtaaggacgggaagaacacgctcagccggcgcgagctgcgggagctgatggagcacgag ctgccgaacttcctcaagtctcagaaggaccccgcggccgtggacaagatcatgagggac ctggacgccaacggggacggacaggtggactttgaggagtttgtcgccctggttgttgga ctttccattgcctgcgagcagtgctaccaggcgcacctgaagaagtatgcgaagaagtaa

DBGET integrated database retrieval system