Betta splendens (Siamese fighting fish): 114865854 Help Entry 114865854         CDS       T08231                                  Symbol npy Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04080   Neuroactive ligand-receptor interaction bspl04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     114865854 (npy)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     114865854 (npy)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114865854 (npy) Cytokines and neuropeptides [BR:bspl04052]  Neuropeptides   GPCR binding    114865854 (npy) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  114865854 NCBI-ProteinID:  XP_029023180 UniProt:  A0A6P7NZ39 LinkDB All DBs Position 11:7785518..7787204 Genome browser AA seq 99 aa AA seqDB search MHPNLVSCLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLIT RQRYGKRSSPEILDTLVSELLLKGSTDALPQSRYDPSLW NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcatcctaacttggtgagctgcttggggaccctggggttccttctgtgggcgctgctg tgcctgggcgccctgacggagggatacccggtgaaaccggagaaccccggagaggacgcc ccagcggaggaactggccaagtactactcagccctgagacactacatcaacctcattaca aggcagaggtacgggaagaggtccagtcctgagatcctggacacgctggtctcagagctg ctgctgaagggaagcacagacgcacttccacagtcaagatatgacccatcgttgtggtga

DBGET integrated database retrieval system