Betta splendens (Siamese fighting fish): 114866051 Help Entry 114866051         CDS       T08231                                  Name (RefSeq) CD59 glycoprotein-like   KO K04008   CD59 antigen Organism bspl  Betta splendens (Siamese fighting fish) Brite KEGG Orthology (KO) [BR:bspl00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bspl04147]     114866051    04090 CD molecules [BR:bspl04090]     114866051    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bspl00537]     114866051 Exosome [BR:bspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114866051   Exosomal proteins of other body fluids (saliva and urine)    114866051   Exosomal proteins of colorectal cancer cells    114866051 CD molecules [BR:bspl04090]  Proteins   114866051 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bspl00537]  Antigens   114866051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  114866051 NCBI-ProteinID:  XP_029023484 UniProt:  A0A6P7P1E9 LinkDB All DBs Position 11:complement(11103951..11105545) Genome browser AA seq 102 aa AA seqDB search MMRSAVVFCLAVSFAVFGFGLSLQCYSCPEGSSSCDVKQQCSQGEDACLKLKSDGLVYTE CIRYTDCSFSPLAVRYALPKFTYTCCQTNLCNGKSFFEGLFG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgatgagaagcgccgtggtgttttgcttggctgtcagctttgccgtgtttggatttggc ctgtcgctgcagtgctactcctgccctgaaggctccagcagctgtgacgtgaagcagcag tgcagccaaggcgaagacgcctgcctcaagctcaaaagtgatggcctggtctacactgaa tgcatcagatacacggactgcagcttcagcccgctggccgtcagatacgccttgcctaag ttcacctacacctgctgccagacaaacctctgcaatgggaaaagtttctttgagggtttg ttcggttaa

DBGET integrated database retrieval system