Betta splendens (Siamese fighting fish): 114867580 Help Entry 114867580         CDS       T08231                                  Symbol txn Name (RefSeq) thioredoxin isoform X2   KO K03671   thioredoxin Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04621   NOD-like receptor signaling pathway bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114867580 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114867580 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bspl03110]     114867580 (txn) Chaperones and folding catalysts [BR:bspl03110]  Protein folding catalysts   Protein disulfide isomerase    114867580 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 OST3_OST6 A6-like_Thioredoxin-like_C AhpC-TSA Thioredoxin_7 Thioredoxin_8 Thioredoxin_9 Redoxin PedC-like DIM1 Motif Other DBs NCBI-GeneID:  114867580 NCBI-ProteinID:  XP_029026224 UniProt:  A0A6P7PA45 LinkDB All DBs Position 2 Genome browser AA seq 107 aa AA seqDB search MVREVVDLDDFKKILKEAGDKLVVVDFTATWCGPCKQIGPIFVKMSEDPANKDIVFLKVD VDEAEDVSSSCGISCMPTFHFYKNGEKVDEFSGANAKQLSEALEKNR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggttcgcgaagtagtagatctggatgacttcaagaagatcctgaaggaagcaggagac aagctggtggtggtggacttcactgccacatggtgcggcccctgcaagcagatcggcccc atatttgtaaaaatgtcagaagaccctgcgaacaaggacatagtgttcctgaaggtggac gtggatgaagctgaggatgtgagttcaagctgcgggatttcttgcatgcccacattccac ttttacaagaacggagaaaaggtggatgagttctctggcgctaacgcgaagcaactgtct gaggcactggagaagaatagatag

DBGET integrated database retrieval system