Betta splendens (Siamese fighting fish): 114867589 Help Entry 114867589         CDS       T08231                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04621   NOD-like receptor signaling pathway bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     114867589  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114867589  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bspl03110]     114867589 Chaperones and folding catalysts [BR:bspl03110]  Protein folding catalysts   Protein disulfide isomerase    114867589 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA OST3_OST6 Thioredoxin_7 Thioredoxin_2 Thioredoxin_9 Thioredoxin_8 DIM1 Redoxin Motif Other DBs NCBI-GeneID:  114867589 NCBI-ProteinID:  XP_029026234 UniProt:  A0A6P7PA54 LinkDB All DBs Position 2:21597344..21599682 Genome browser AA seq 107 aa AA seqDB search MVRQVKNSAEFKQALSDAGGKLVVVDFTATWCGPCRMIGPVFEELSTNSEYSNVVFLKVD VDEASDVSGECNISCMPTFQFFKNGSKVHEFSGADKNKLIDGLQKFC NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcagacaagtgaaaaactccgcagagttcaaacaggccctgagcgacgcagggggc aaactagttgtggtggacttcacagcaacatggtgcggcccctgcagaatgatcggcccc gtatttgaagaactgtcgactaacagtgaatacagcaacgttgttttcctgaaggtcgat gtggacgaggcgtcggatgtgagtggagagtgcaacatctcatgcatgcccacgttccag tttttcaagaacggatctaaggtgcacgaattctctggcgcggacaaaaacaaactgata gatggactgcagaagttctgttag

DBGET integrated database retrieval system