Betta splendens (Siamese fighting fish): 114868456 Help Entry 114868456         CDS       T08231                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04814   Motor proteins bspl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bspl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     114868456 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114868456 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bspl03037]     114868456 (dynll2a)    04812 Cytoskeleton proteins [BR:bspl04812]     114868456 (dynll2a) Cilium and associated proteins [BR:bspl03037]  Motile cilia and associated proteins   Dynein arm    114868456 (dynll2a) Cytoskeleton proteins [BR:bspl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      114868456 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  114868456 NCBI-ProteinID:  XP_029027895 UniProt:  A0A6P7P6H0 LinkDB All DBs Position 13:complement(4618431..4621756) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaagctgtgatcaagaacgccgacatgtccgaggacatgcagcaggac gccgtggactgtgccacgcaggcgatggagaagtacaacatagagaaggacatcgcggcg tacatcaagaaggagtttgacaagaagtacaacccgacctggcactgcatcgttggtagg aactttggcagctacgtcacccacgagacaaagcacttcatttacttctacttgggccaa gtggccattttgctcttcaagtctggctga

DBGET integrated database retrieval system