Betta splendens (Siamese fighting fish): 114869723 Help Entry 114869723         CDS       T08231                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl04010   MAPK signaling pathway bspl04068   FoxO signaling pathway bspl04081   Hormone signaling bspl04114   Oocyte meiosis bspl04140   Autophagy - animal bspl04150   mTOR signaling pathway bspl04810   Regulation of actin cytoskeleton bspl04910   Insulin signaling pathway bspl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:bspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114869723    04068 FoxO signaling pathway     114869723    04150 mTOR signaling pathway     114869723   09133 Signaling molecules and interaction    04081 Hormone signaling     114869723  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114869723   09143 Cell growth and death    04114 Oocyte meiosis     114869723   09142 Cell motility    04810 Regulation of actin cytoskeleton     114869723  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     114869723    04914 Progesterone-mediated oocyte maturation     114869723  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bspl04052]     114869723 Cytokines and neuropeptides [BR:bspl04052]  Neuropeptides   Unclassified    114869723 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta DUF5408 Motif Other DBs NCBI-GeneID:  114869723 NCBI-ProteinID:  XP_029030007 UniProt:  A0A6P7PB69 LinkDB All DBs Position 14:complement(2704399..2704961) Genome browser AA seq 90 aa AA seqDB search MAALWLHTTVLLVLLATWCPSSQGFPAETLCGGELVDALQIVCGERNFFYTARTTDEDPV QPQRQRRSLNIAAMCCFMTCTLSDLQDLCH NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctctggctccacaccacggtcctgctggtcctgctggccacgtggtgccca agctcccaaggcttccccgccgagactctgtgtgggggagagctggtcgacgctcttcaa atcgtctgtggggaacggaattttttctacacggccaggacgaccgatgaggacccagtg cagcctcaaaggcagaggaggagcctaaacatcgcagctatgtgctgctttatgacctgc accctctccgacctgcaggacttatgtcactga

DBGET integrated database retrieval system