Betta splendens (Siamese fighting fish): 23631938 Help Entry 23631938          CDS       T08231                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism bspl  Betta splendens (Siamese fighting fish) Pathway bspl00190   Oxidative phosphorylation bspl01100   Metabolic pathways Module bspl_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:bspl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     23631938 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bspl03029]     23631938 (ND4L) Enzymes [BR:bspl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      23631938 (ND4L) Mitochondrial biogenesis [BR:bspl03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     23631938 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  23631938 NCBI-ProteinID:  YP_009123855 UniProt:  A0A0C6E3W3 LinkDB All DBs Position MT:10092..10388 Genome browser AA seq 98 aa AA seqDB search MTPVHFAFSSAFMLSLSGLAFYRTHLLSAFLCLEGMMLSLFIAISLWALQLDTTGFLTSP VLLLAFSACEASAGLALLVATARTHGTDRLQNLNLFQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacccctgttcactttgccttctcatcagcttttatactaagcctatcgggcctggca ttttatcgaacccaccttctctctgctttcctttgtttagagggtataatactttcacta tttattgcaatctcattatgagccctacaactagacactaccggctttttaactagtcct gtacttcttttagcattttcagcctgtgaagctagcgcagggttagccttactcgttgct acagctcgcacccatggcacagaccgactacaaaatcttaatctttttcaatgctaa

DBGET integrated database retrieval system