KEGG   Brevibacterium spongiae: L1F31_18480
Entry
L1F31_18480       CDS       T09030                                 
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
bspo  Brevibacterium spongiae
Pathway
bspo03030  DNA replication
bspo03430  Mismatch repair
bspo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bspo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    L1F31_18480
   03430 Mismatch repair
    L1F31_18480
   03440 Homologous recombination
    L1F31_18480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bspo03032]
    L1F31_18480
   03400 DNA repair and recombination proteins [BR:bspo03400]
    L1F31_18480
   03029 Mitochondrial biogenesis [BR:bspo03029]
    L1F31_18480
DNA replication proteins [BR:bspo03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    L1F31_18480
DNA repair and recombination proteins [BR:bspo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     L1F31_18480
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    L1F31_18480
Mitochondrial biogenesis [BR:bspo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    L1F31_18480
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2
Other DBs
NCBI-ProteinID: UVI36070
UniProt: A0ABY5SP37
LinkDB
Position
complement(4131453..4132085)
AA seq 210 aa
MAGETVITVVGNLTSDPELRFTPNGAAVANFTVASTPRIFDRQANEFKDGETLFLRCSVW
REMGENVAESLQRGTRVIVQGRLKSRSFETKEGEKRTVMELDVDEVGPSLRRATAQVTKN
TPGGGGFSGGGNFGGGQGGGGQQGGFGNQQSSGWGNNPQQGGPQGGQRQGGYGQGGQGGN
NAPANDPWASSNPQSGNGGWGNPGADEPPF
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcaggcgaaacagtcatcacggtcgtcgggaacctcaccagcgatcccgaactgcgc
ttcacacctaacggtgcggcagtcgcaaacttcaccgtggcctcgacgccgcgtatcttc
gaccgtcaggccaacgagttcaaggacggggaaaccctgttcctgcgctgctcggtatgg
cgtgaaatgggagagaacgtcgccgaatccctgcagcgcggtacacgggtcatcgttcag
ggccgtctgaagtcccggtccttcgaaaccaaggaaggcgagaagcgcaccgtcatggag
ctggatgtcgacgaagtcggccccagcctgcgacgcgccaccgcccaggtgacgaagaac
acccccggcggcggaggattctccggcggcggcaacttcggcggaggccagggcggaggc
ggccagcaaggcggcttcggcaaccagcagtcgtcgggatggggcaacaacccccagcag
ggcggtcctcagggcggccagcgtcagggcggctacggccagggcggccagggcggcaac
aacgcaccggcgaacgatccgtgggcatcatcgaacccgcagagcggcaacggcggctgg
ggcaacccgggtgccgacgaacccccgttctga

DBGET integrated database retrieval system