KEGG   Bacillus subtilis QB928: B657_11300
Entry
B657_11300        CDS       T02292                                 
Symbol
med
Name
(GenBank) Positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bsq  Bacillus subtilis QB928
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsq03000]
    B657_11300 (med)
Transcription factors [BR:bsq03000]
 Prokaryotic type
  Other transcription factors
   Others
    B657_11300 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: AFQ57047
LinkDB
Position
1186125..1187078
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLVDQDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattgagtggatgtggacaa
actccgttcaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatccaaatacaatgtg
gacgtctattataaagaaggcgttaaaacagaagaagatatcataaatgcgattgaggat
tttcataagaggggcgtcaatctgctctacggccatgggagtgaatatgctgaggtgttt
aacttggtcggcgaagattatccagatatggaattcgtcatttccaatgcgaaagcgaaa
gctgataatgtaacaagtgtccattttagcggggaagcaatgggcttttttggaggaatg
actgctgcccatatgtcgaaaacgaatcaggtcggtgtaattgcttcctttacgtggcag
cctgaggttgacggttttatcaaaggggccaagtatgaaaatccggatatagaggtaaat
acgaaatatacggatcattgggatgatgatacaacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcccgccggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggtctttatgccataggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcctatgaaatcatt
gctgaacaatttaataaaggcacccttgagggcggcgatcattactacgacctgaacacg
ggagtcgttgagatgggaacattcagcccgctcgtcgatcaagactttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgagctgccaaaaaacgagtaa

DBGET integrated database retrieval system