KEGG   Bacillus subtilis QB928: B657_30190
Entry
B657_30190        CDS       T02292                                 
Symbol
bioI
Name
(GenBank) Cytochrome P450 for pimelic acid formation forbiotin
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00780  Biotin metabolism
bsq01100  Metabolic pathways
bsq01240  Biosynthesis of cofactors
Module
bsq_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B657_30190 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsq00199]
    B657_30190 (bioI)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     B657_30190 (bioI)
Cytochrome P450 [BR:bsq00199]
 Cytochrome P450, bacteria type
  CYP107 family
   B657_30190 (bioI)
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: AFQ58861
LinkDB
Position
complement(3020665..3021852)
AA seq 395 aa
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTE
GNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTI
RQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLNLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcgtcaactgcatcttctgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatacccgggctgg
tatgtcacaggatatgaagaaacggctgctattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccagcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagaacgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtaaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agttttgtcatagctaacattataggtgtaccggaggaagatagggagcaattaaaggag
tgggctgcgagtctcattcaaacgattgattttacccgctcaagaaaggcattaacagag
ggcaatattatggctgtgcaggctatggcatatttcaaagagctgattcaaaagagaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggagagaaaaggataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagcttttgaaa
ctgagagaaaatccagatcttattggtaccgcagtcgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatctgcggggtgacgatc
cgtcaaggagaacaagtctatcttttgttaggagcggctaatcgagaccctagcatattc
acgaaccccgatgtcttcgatattacgagaagtcctaatccgcatctttcattcgggcat
ggccatcatgtttgcttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
actcttctgcagcgaatgcccagccttaatcttgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system