KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_18640
Entry
BSUW23_18640      CDS       T01302                                 

Gene name
bacA
Definition
(GenBank) bacilysin biosynthesis protein, dehydratase
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00998  Biosynthesis of various secondary metabolites - part 2
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
Module
bss_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSUW23_18640 (bacA)
Enzymes [BR:bss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     BSUW23_18640 (bacA)
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: ADM39762
UniProt: E0TW20
LinkDB
Position
complement(3680076..3680690)
AA seq 204 aa
MIILDNSIQTKKRTDSISKLITVNTLGPEGTSSEYAAKHFISNFTLQQGLNSKLSLHDTF
ESCIERTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFEFSDDM
LDSSVIVSHPSPINLIKYFTRKDVRFKLVNSTSQAARKVKEGLYDIALTNELARQKYGLT
FVKTFKSIPMSWSLFGKGDVDYEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcagacaaaaaaaagaactgattcaatatccaaactc
attacagtcaacacgctcggccctgaggggacaagcagtgagtacgcagcaaaacatttc
atctccaattttactcttcaacaagggctgaacagtaaattgtccttgcatgatacattt
gaatcatgtatcgaaaggacccttcaaagcccgctggaatatactatcgtcccacacgct
tatgacggcattaagcatttctatatgaggccggatttgcagctattgcagatcttcagg
tgcgatacaccgatgtacggcctggctgttcgtcctgattttgaattcagcgacgatatg
cttgattcatctgttatcgtttcacatccttcacccattaatttaatcaaatattttacc
cgcaaagatgtacgtttcaaactggtcaattcgaccagtcaagctgcaagaaaagtaaaa
gaaggcttatatgacattgccttaaccaatgagcttgcacggcaaaagtacgggcttaca
tttgtgaaaacatttaaaagcattcctatgagctggtcattattcggaaaaggagacgtt
gattatgaaaactaa

DBGET integrated database retrieval system