Burkholderia stagnalis: WT74_06745 Help Entry WT74_06745        CDS       T04885                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bstg  Burkholderia stagnalis Pathway bstg00998   Biosynthesis of various antibiotics bstg01100   Metabolic pathways bstg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bstg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WT74_06745    00074 Mycolic acid biosynthesis     WT74_06745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WT74_06745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOK52433 UniProt:  A0A124UW87 LinkDB All DBs Position 1:1503369..1503620 Genome browser AA seq 83 aa AA seqDB search MTDAEILERIRAIFNENFAIEPARVTPDTHLFEELDLDSIDAVDLAIKLQELTGQRIKPE EFKSVRTVGDVIAAVHTLLARGR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgcagaaatccttgagcgtatccgcgccatcttcaacgagaacttcgcgatc gagccggcgcgcgtgacgcccgacacgcatcttttcgaggaactcgatctcgacagcatc gatgcggtcgatctcgccatcaagctccaggaactgacggggcagcgcatcaagccggaa gaattcaaatcggtgcgcaccgtcggcgacgtgatcgccgccgttcacacgctgctcgcg cgcggtcgatga

DBGET integrated database retrieval system