Burkholderia stagnalis: WT74_08915 Help Entry WT74_08915        CDS       T04885                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism bstg  Burkholderia stagnalis Brite KEGG Orthology (KO) [BR:bstg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bstg03036]     WT74_08915    03400 DNA repair and recombination proteins [BR:bstg03400]     WT74_08915 Chromosome and associated proteins [BR:bstg03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WT74_08915 DNA repair and recombination proteins [BR:bstg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WT74_08915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AOK52801 UniProt:  A0A104QAG1 LinkDB All DBs Position 1:complement(2022677..2022916) Genome browser AA seq 79 aa AA seqDB search MEQIVKLIREYEIDLRVVEVRLSNLAPTGMSRRKQVEPRYVDPVSGATWAGRGKRPRWMQ GRNPEEFRIASPGKRARES NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttggaacaaatcgtcaagctgattcgcgagtacgagatcgatttgcgggtggtggaggtg aggttgtcgaacctcgcacctaccggcatgtcccgccgcaagcaggtggaaccgcgctac gtcgatccggtgagcggcgcgacgtgggcgggccgcggcaagcggccgcgatggatgcaa ggacgcaatccggaagagttcaggatcgcgtcgcccggcaagcgggcacgcgagtcgtga

DBGET integrated database retrieval system