Burkholderia stagnalis: WT74_09485 Help Entry WT74_09485        CDS       T04885                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism bstg  Burkholderia stagnalis Pathway bstg02024   Quorum sensing bstg03018   RNA degradation Brite KEGG Orthology (KO) [BR:bstg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     WT74_09485  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     WT74_09485  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bstg03019]     WT74_09485    03036 Chromosome and associated proteins [BR:bstg03036]     WT74_09485 Messenger RNA biogenesis [BR:bstg03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      WT74_09485 Chromosome and associated proteins [BR:bstg03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     WT74_09485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AOK54391 UniProt:  A0A119MR02 LinkDB All DBs Position 1:complement(2164096..2164335) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDAEASS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgcaaggagcac gttccggtttcgatttatctcgtgaacggcatcaagctccaagggaacatcgaatcgttc gaccagtacgtcgtgttgctccgtaatacggtgacccagatggtctacaagcacgccatc tcgacggtcgtgccggcgcgcccggtgaatttccacccggacgcggaagcctcgtcctaa

DBGET integrated database retrieval system