Burkholderia stagnalis: WT74_14630 Help Entry WT74_14630        CDS       T04885                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bstg  Burkholderia stagnalis Pathway bstg00998   Biosynthesis of various antibiotics bstg01100   Metabolic pathways bstg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bstg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WT74_14630    00074 Mycolic acid biosynthesis     WT74_14630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WT74_14630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOK54458 UniProt:  A0A104QVT8 LinkDB All DBs Position 1:complement(3270305..3270565) Genome browser AA seq 86 aa AA seqDB search MNALEQELATLIVGELNLEDVPLDMVSADTPLYGEGFGLDSIDILEIALLISKKYGFELR SDNPDNERIFATLGALAAYVAAHRAK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaacaagagctcgccacgctgatcgtcggcgaactgaatctcgaagac gtgccgctcgatatggtgagcgccgataccccgctgtatggggaaggattcgggctcgac tccatcgacatcctggaaatcgcgctgctgatctcgaagaagtacggcttcgagctgcgc tcggacaatccggataacgaacggatcttcgcgacgctcggcgcgctcgccgcgtacgtc gcggcgcaccgcgcgaagtga

DBGET integrated database retrieval system