Burkholderia stabilis: BBJ41_09915 Help Entry BBJ41_09915       CDS       T04946                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bstl  Burkholderia stabilis Brite KEGG Orthology (KO) [BR:bstl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bstl03032]     BBJ41_09915    03036 Chromosome and associated proteins [BR:bstl03036]     BBJ41_09915    03400 DNA repair and recombination proteins [BR:bstl03400]     BBJ41_09915 DNA replication proteins [BR:bstl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BBJ41_09915 Chromosome and associated proteins [BR:bstl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BBJ41_09915 DNA repair and recombination proteins [BR:bstl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BBJ41_09915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOR67829 UniProt:  A0A1D7ZD66 LinkDB All DBs Position 1:complement(2132973..2133251) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagaccggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system