Bacteriovorax stolpii: C0V70_08430 Help Entry C0V70_08430       CDS       T05263                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsto  Bacteriovorax stolpii Pathway bsto00998   Biosynthesis of various antibiotics bsto01100   Metabolic pathways bsto01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsto00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0V70_08430    00074 Mycolic acid biosynthesis     C0V70_08430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0V70_08430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUN98134 UniProt:  A0A2K9NTR0 LinkDB All DBs Position complement(1704613..1704864) Genome browser AA seq 83 aa AA seqDB search MLSNAEVRTKVLDIIADIALDDDVTGIKDEVALREQLDLDSMDFLDIVMELKKRHKIEVP QEDYPRLATMASCVEYLAPKFNQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgttatcaaacgcagaagtacgtacaaaagttctagacatcatcgctgacatcgctctt gatgacgatgtaacaggaatcaaagacgaagtggcactaagagagcaacttgacctggat tcaatggacttcctggacatcgttatggagctaaaaaagcgtcacaaaatcgaagttcca caagaagactacccaagacttgctacaatggcatcttgtgttgagtaccttgctccgaaa ttcaaccaataa

DBGET integrated database retrieval system