Bacteriovorax stolpii: C0V70_14770 Help Entry C0V70_14770       CDS       T05263                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsto  Bacteriovorax stolpii Pathway bsto00998   Biosynthesis of various antibiotics bsto01100   Metabolic pathways bsto01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsto00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0V70_14770 (acpP)    00074 Mycolic acid biosynthesis     C0V70_14770 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0V70_14770 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 MEIOC Nup192 Motif Other DBs NCBI-ProteinID:  AUN99345 UniProt:  A0A2K9NWB3 LinkDB All DBs Position 3012868..3013095 Genome browser AA seq 75 aa AA seqDB search MKDKVIKLISDATKIDIAKINLETSFVDDLNLDSLDIVELMMKMEDEFGVEIPEEDAEGL KTVKDIVAYLEKKQA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaagacaaggttattaaactaatcagcgacgctacaaaaattgatatcgctaaaatc aatcttgaaacaagtttcgttgacgatctaaacctagactcactagatatcgtagaacta atgatgaaaatggaagacgaatttggtgtagaaattcctgaggaagatgctgaaggacta aaaacggtaaaagatatcgttgcttacctagaaaagaaacaagcttaa

DBGET integrated database retrieval system