KEGG   Bacillus subtilis subsp. subtilis 168: BSU00910
Entry
BSU00910          CDS       T00010                                 
Symbol
ispF
Name
(RefSeq) 2-D-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU00910 (ispF)
Enzymes [BR:bsu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     BSU00910 (ispF)
SSDB
Motif
Pfam: YgbB
Other DBs
NCBI-GeneID: 936634
NCBI-ProteinID: NP_387972
Pasteur: BG10153
BSORF: BG10153
UniProt: Q06756 A0A6M3Z6H3
Structure
LinkDB
Position
110480..110956
AA seq 158 aa
MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAVGEGDIGK
HFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEG
LEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtttagaattggacaaggatttgatgtgcatcaattagtggagggccgtcctctcatt
attggcggaattgaaatcccgtacgaaaaagggctgcttggccattctgatgcagacgta
ttgttgcataccgtcgctgacgcctgcctgggagctgtgggtgaaggagacataggcaag
cattttcctgacacagatcccgagttcaaggacgcagattctttcaaattacttcagcat
gtctggggaatcgtgaaacagaaggggtatgtccttgggaacattgattgcaccatcata
gcgcaaaagccgaagatgctgccgtacatagaagatatgagaaaaagaattgctgaaggc
cttgaggcagatgtttctcaagtaaatgtaaaagcaacaacgacagaaaagcttggattt
acaggccgggcggaaggaatagcggctcaggcgacagtactgatacaaaaaggctaa

DBGET integrated database retrieval system