KEGG   Bacillus subtilis subsp. subtilis 168: BSU08630
Entry
BSU08630          CDS       T00010                                 
Symbol
yfhQ
Name
(RefSeq) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU08630 (yfhQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU08630 (yfhQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     BSU08630 (yfhQ)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BSU08630 (yfhQ)
 Prokaryotic type
     BSU08630 (yfhQ)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 939222
NCBI-ProteinID: NP_388743
Pasteur: BG12891
UniProt: O31584 A0A6M4JEA0
LinkDB
Position
935656..936765
AA seq 369 aa
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPY
FLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDF
GGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAF
ISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIK
TMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQAD
ISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAG
EAAAISAAP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaacgtacttgaagacaaattaaaacaaaaagacatacagcaatttcgcgatgattta
atctcatggtttgaacgagagcagcgcgttttgccgtggagagaggaccaagatccatat
aaggtgtgggtatctgaagtgatgctgcagcaaacgagagtagagacagtgattccttac
tttctccggtttgtagaacaattcccgacagtggaagcgctcgctgatgctgatgaagaa
aaggtgctgaaagcatgggaagggctcggctattattcgcgagtcagaaacctgcaaagc
gcggtaaaagaagtgaaacaggaatacggcggcattgttcctccagacgagaaagatttt
ggcgggttaaaaggcgtcggcccttatacaaagggagcggtgctcagcattgcctacaat
aaacccattcccgcggttgacggaaatgtgatgcgtgtcatgtccaggattctatctatt
tgggatgatattgccaaaccaaaaacaagaacgatctttgaagacgccatacgagctttt
atttccaaagaaaaaccatctgaatttaatcagggcttgatggagcttggagccttgatc
tgtacgccaaaatcaccctcatgcctgctttgcccggttcagcagcattgctcagcattt
gaagaaggcactgaacgggagcttccggtaaaaagcaaaaagaaaaagcccgggatcaaa
accatggccgcgatcgtactgactgatgaagacggacaagtgtatatccacaaacggccg
tctaaaggtttgctcgccaacctgtgggaattcccgaatcttgaaacacaaaaagggatc
aaaactgagcgtgaacagctcattgctttcttagaaaacgaatatggcatacaagctgat
atcagtgatctgcaaggtgtagtcgagcatgttttcacccacctggtatggaatatttca
gtgtttttcggtaaagtaaaacaagtgtcggataccagcaagctgaaaaaagtaacgaaa
gaagagctcgaacaatttgcgttcccggtgtcacatcaaaaaatctggaagatggcagga
gaagcagccgccatctcggctgctccgtaa

DBGET integrated database retrieval system