KEGG   Bacillus subtilis subsp. subtilis 168: BSU15870
Entry
BSU15870          CDS       T00010                                 
Symbol
recG
Name
(RefSeq) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU15870 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU15870 (recG)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU15870 (recG)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU15870 (recG)
SSDB
Motif
Pfam: Helicase_C DEAD RecG_wedge RecG_dom3_C ResIII SecA_DEAD tRNA_anti-codon Cdd1 AAA_30 IstB_IS21 IMS_HHH
Other DBs
NCBI-GeneID: 936730
NCBI-ProteinID: NP_389469
Pasteur: BG13399
UniProt: O34942 A0A6M3ZAK9
LinkDB
Position
1659810..1661858
AA seq 682 aa
MKQHQQTSIANIKGIGPETEKTLNELGIYDISDLLNYFPYRYDDYELRDLEEVKHDERVT
VEGKVHSEPSLTYYGKKRNRLTFRLLVGHYLITAVCFNRPYLKKKLSLGSVVTVSGKWDK
HRQTISVQELKNGPHQEDKSIEPVYSVKENVTVKMMRRFIQQALTQYADSLPDPLPEKLR
KSYKLPDYYQALKAMHQPETREALKLARRRFVYEEFLLFQLKMQAFRKAEREQTQGIRQR
FSNEELMRFIKSLPFPLTNAQSRVLREITADMSSPYRMNRLLQGDVGSGKTAVAAIALYA
AILSGYQGALMVPTEILAEQHADSLVSLFEKWDVSVALLTSSVKGKRRKELLERLAAGEI
DILVGTHALIQDEVEFKALSLVITDEQHRFGVEQRKKLRNKGQDPDVLFMTATPIPRTLA
ITVFGEMDVSVIDEMPAGRKRIETYWVKHDMLDRILAFVEKELKQGRQAYIICPLIEESD
KLDVQNAIDVYNMLSDIFRGKWNVGLMHGKLHSDEKDQVMREFSANHCQILVSTTVVEVG
VNVPNATIMVIYDADRFGLSQLHQLRGRVGRGEHQSFCILMADPKSETGKERMRIMSETN
DGFELSEKDLELRGPGDFFGKKQSGMPEFKVADMVHDYRALETARQDAANLVASDAFWKE
PEYAVLRDELLKSGVMDGEKLS
NT seq 2049 nt   +upstreamnt  +downstreamnt
gtgaaacaacatcagcaaactagtatagctaacattaagggtattgggccggaaacagaa
aaaacattgaatgaactcggtatttatgacatttctgatcttctgaattatttcccttat
cgctatgatgactacgagctgagggatttagaagaagtaaagcatgatgaaagagtcaca
gtcgaagggaaggttcattcagagccttctcttacctattacggaaaaaaacgaaacagg
ctgacattcaggcttctggtcggccactatttaatcacagccgtatgttttaaccggcct
tatttgaagaagaagctttcgctcggctctgtggtgacggtttcaggtaaatgggacaag
caccgccaaaccatctctgttcaggagttgaaaaacgggccgcatcaagaagacaaaagc
attgaaccagtgtattctgtgaaagaaaatgttaccgtcaaaatgatgaggcgctttatt
cagcaggcgctgacccaatatgcagactcacttcctgatcctcttccggaaaagctaaga
aaaagctataaactgcctgactattatcaagcgttaaaagcaatgcaccagcctgaaaca
agggaagcattaaagcttgccagacggcggtttgtttatgaagaatttttgttgtttcag
ttgaaaatgcaggcgttccgaaaggcggaaagagagcagacacaagggatacggcagcgt
ttttcaaacgaagaactcatgagatttatcaaaagcctcccgtttcccctcacaaacgcc
cagtcacgcgttcttcgcgaaataacagcagacatgtcttctccatacagaatgaaccgt
cttcttcaaggggacgttggatcaggaaaaacggcagtcgccgccattgcactgtatgcc
gcgatcctatccggataccaaggagcgctcatggtgccgacagaaattctggccgagcag
catgctgattcgctcgtttcgctatttgaaaaatgggacgtcagcgttgctcttttgaca
agctctgttaaaggaaagcggcgaaaagaactgcttgagcgtcttgcggcgggtgagatt
gatattcttgtaggaacccatgctttaatccaagacgaggtggagtttaaggcgttgagt
ctcgttattactgatgaacagcacagatttggagttgagcagcgcaaaaagcttcggaac
aaagggcaggatcccgatgttctctttatgacagccactccaatcccaagaacattagcg
atcacagtattcggtgaaatggatgtatctgtcattgatgagatgccggctggacgaaag
cgaattgaaacctattgggtaaaacatgacatgcttgatcgtattttggcatttgtcgaa
aaagaattaaagcaaggcaggcaggcttatatcatctgtccgctgattgaagaatcagat
aagcttgatgtgcaaaacgccattgacgtgtacaatatgctttctgatatttttcgggga
aaatggaatgtcggccttatgcatggaaagctgcattccgatgaaaaagatcaggtcatg
agagaattcagcgcaaatcactgtcaaattctcgtatcaaccactgttgtggaggttggc
gtaaatgttccgaatgcaacaattatggtgatttatgacgccgaccgtttcggactatca
cagcttcaccagctgcgcggccgtgttggacggggtgagcatcaatctttctgtattctg
atggctgatccaaaatcagaaacagggaaagaacggatgaggatcatgtcggagaccaat
gacggtttcgagctgtctgaaaaggatctggaactgagaggtcccggtgatttcttcggg
aaaaaacaaagcggaatgccggaatttaaagtggcggacatggttcatgattacagagcg
cttgaaacggcaaggcaggatgctgcgaatcttgtggcttctgacgcgttctggaaggag
ccggaatacgctgtgttaagagatgaattgctgaagagcggagtaatggacggggaaaaa
ttaagctga

DBGET integrated database retrieval system