Bacillus subtilis subsp. subtilis 168: BSU22410 Help Entry BSU22410          CDS       T00010                                  Symbol panD Name (RefSeq) aspartate 1-decarboxylase   KO K01579   aspartate 1-decarboxylase [EC:4.1.1.11] Organism bsu  Bacillus subtilis subsp. subtilis 168 Pathway bsu00410   beta-Alanine metabolism bsu00770   Pantothenate and CoA biosynthesis bsu01100   Metabolic pathways bsu01110   Biosynthesis of secondary metabolites bsu01240   Biosynthesis of cofactors Module bsu_M00119   Pantothenate biosynthesis, valine/L-aspartate => pantothenate Brite KEGG Orthology (KO) [BR:bsu00001]  09100 Metabolism   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     BSU22410 (panD)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BSU22410 (panD) Enzymes [BR:bsu01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.11  aspartate 1-decarboxylase      BSU22410 (panD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_decarbox DUF4467 PQQ_2 ADH_N Motif Other DBs NCBI-GeneID:  939033 NCBI-ProteinID:  NP_390122 Pasteur:  BG11493 UniProt:  P52999 A0A6M4JKA2 LinkDB All DBs Position complement(2352592..2352975) Genome browser AA seq 127 aa AA seqDB search MYRTMMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQIVNNNNGARLETYII PGKRGSGVICLNGAAARLVQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIEQMLGN EPARTIL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtatcgaacaatgatgagcggcaaacttcacagggcaactgttacggaagcaaacctg aactatgtgggaagcattacaattgatgaagatctcattgatgctgtgggaatgcttcct aatgaaaaagtacaaattgtgaataataataatggagcacgtcttgaaacgtatattatt cctggtaaacggggaagcggcgtcatatgcttaaacggtgcagccgcacgccttgtgcag gaaggagataaggtcattattatttcctacaaaatgatgtctgatcaagaagcggcaagc catgagccgaaagtggctgttctgaatgatcaaaacaaaattgaacaaatgctggggaac gaaccagcccgtacaattttgtag

DBGET integrated database retrieval system