KEGG   Bacillus subtilis subsp. subtilis 168: BSU22870
Entry
BSU22870          CDS       T00010                                 
Symbol
fni
Name
(RefSeq) isopentenyl-diphosphate delta-isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
bsu_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU22870 (fni)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     BSU22870 (fni)
SSDB
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase DeoC
Other DBs
NCBI-GeneID: 938985
NCBI-ProteinID: NP_390168
Pasteur: BG11440
BSORF: BG11440
UniProt: P50740 A0A6M3ZDJ3
Structure
LinkDB
Position
complement(2393602..2394651)
AA seq 349 aa
MTRAERKRQHINHALSIGQKRETGLDDITFVHVSLPDLALEQVDISTKIGELSSSSPIFI
NAMTGGGGKLTYEINKSLARAASQAGIPLAVGSQMSALKDPSERLSYEIVRKENPNGLIF
ANLGSEATAAQAKEAVEMIGANALQIHLNVIQEIVMPEGDRSFSGALKRIEQICSRVSVP
VIVKEVGFGMSKASAGKLYEAGAAAVDIGGYGGTNFSKIENLRRQRQISFFNSWGISTAA
SLAEIRSEFPASTMIASGGLQDALDVAKAIALGASCTGMAGHFLKALTDSGEEGLLEEIQ
LILEELKLIMTVLGARTIADLQKAPLVIKGETHHWLTERGVNTSSYSVR
NT seq 1050 nt   +upstreamnt  +downstreamnt
gtgactcgagcagaacgaaaaagacaacacatcaatcatgccttgtccatcggccagaag
cgggaaacaggtcttgatgatattacgtttgttcacgtcagtctgcccgatcttgcatta
gaacaagtagatatttccacaaaaatcggcgaactttcaagcagttcgccgatttttatc
aatgcaatgactggcggcggcggaaaacttacatatgagattaataaatcgcttgcgcga
gcggcttctcaggctggaattccccttgctgtgggatcgcaaatgtcagcattaaaagat
ccatcagagcgtctttcctatgaaattgttcgaaaggaaaacccaaacgggctgattttt
gccaacctgggaagcgaggcaacggctgctcaggcaaaggaagccgttgagatgattgga
gcaaacgcactgcagatccacctcaatgtgattcaggaaattgtgatgcctgaaggggac
agaagctttagcggcgcattgaaacgcattgaacaaatttgcagccgggtcagtgtaccg
gtcattgtgaaagaagtcggcttcggtatgagcaaagcatcagcaggaaagctgtatgaa
gctggtgctgcagctgttgacattggcggttacgggggaacaaatttctcgaaaatcgaa
aatctccgaagacagcggcaaatctccttttttaattcgtggggcatttcgacagctgca
agtttggcggaaatccgctctgagtttcctgcaagcaccatgatcgcctctggcggtctg
caagatgcgcttgacgtggcaaaggcaattgcgctgggggcctcttgcaccggaatggca
gggcattttttaaaagcgctgactgacagcggtgaggaaggactgcttgaggagattcag
ctgatccttgaggaattaaagttgattatgaccgtgctgggtgccagaacaattgccgat
ttacaaaaggcgccccttgtgatcaaaggtgaaacccatcattggctcacagagagaggg
gtcaatacatcaagctatagtgtgcgataa

DBGET integrated database retrieval system