KEGG   Bacillus subtilis subsp. subtilis 168: BSU25130
Entry
BSU25130          CDS       T00010                                 
Symbol
yqfS
Name
(RefSeq) endonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU25130 (yqfS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU25130 (yqfS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     BSU25130 (yqfS)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     BSU25130 (yqfS)
SSDB
Motif
Pfam: AP_endonuc_2 OST3_OST6
Other DBs
NCBI-GeneID: 937922
NCBI-ProteinID: NP_390392
Pasteur: BG11665
UniProt: P54476 A0A6M4JNG3
LinkDB
Position
complement(2593281..2594174)
AA seq 297 aa
MLRIGSHVSMSGKHMLLAASQEAVSYGANTFMIYTGAPQNTRRKKIEDLNIEAGRAHMQE
NGIDEIIVHAPYIINIGNTTNPSTFELGVDFLRSEIERTAAIGAKQIVLHPGAHVGAGAE
AGIKKIIEGLNEVIDPNQNVQIALETMAGKGSECGRSFEELAQIIEGVTHNEQLSVCFDT
CHTHDAGYNIVEDFDGVLNEFDKIIGIDRIKVLHINDSKNVKGARKDRHENIGFGEIGFD
ALQYVVHHEQLKDIPKILETPYVGEDKKNKKPPYRFEIEMLKEKQFDDTLLEKILQQ
NT seq 894 nt   +upstreamnt  +downstreamnt
ttgctgagaataggctcacacgtctctatgagcggaaaacatatgcttctggctgcaagc
caggaagcagtctcttatggggcgaatacgtttatgatctatacaggcgcaccgcaaaat
acgcgccgaaagaaaattgaagacttaaatatagaagcaggccgggcacatatgcaagaa
aacggcattgacgagattatcgtacacgcgccttatattattaatattggcaacacgaca
aatccgtccacttttgagctgggtgttgattttcttcgttcagaaattgaacggacagcg
gccatcggagcgaagcaaattgtccttcatcctggcgctcacgtaggggcaggagctgaa
gccggcatcaaaaaaattattgaaggcttaaatgaagtgattgatccgaatcaaaatgtc
cagattgcattagaaacaatggctggaaaaggatcagaatgcggcagaagctttgaggag
cttgcgcagattatcgaaggcgttacacacaatgagcagctgtcagtgtgctttgacacg
tgccatacacatgatgccgggtataacattgtcgaagactttgacggagtgctaaatgag
ttcgataaaatcattggcattgaccgtattaaagtgcttcatatcaatgacagcaaaaat
gtcaaaggtgcgagaaaagaccgccatgaaaatattggctttggtgaaataggttttgac
gcactgcaatatgttgttcaccatgagcagttaaaagacattccaaaaattcttgaaaca
ccatacgtcggtgaagataaaaagaacaaaaaaccgccataccgttttgagattgaaatg
ctgaaagaaaaacaatttgatgatacattgcttgaaaagattttacagcaataa

DBGET integrated database retrieval system