KEGG   Bifidobacterium subtile: BS3272_05735
Entry
BS3272_05735      CDS       T07068                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsue  Bifidobacterium subtile
Pathway
bsue00260  Glycine, serine and threonine metabolism
bsue00750  Vitamin B6 metabolism
bsue01100  Metabolic pathways
bsue01110  Biosynthesis of secondary metabolites
bsue01120  Microbial metabolism in diverse environments
bsue01230  Biosynthesis of amino acids
Module
bsue_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BS3272_05735
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BS3272_05735
Enzymes [BR:bsue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BS3272_05735
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C CSN8_PSD8_EIF3K
Other DBs
NCBI-ProteinID: QOL37376
LinkDB
Position
1320483..1321985
AA seq 500 aa
MNTFHSTRGVNDAINGEALSAKQAIRRGLAEDGGLFVTDALGERTVDVAALVGKSYQEIA
ASVLGALLDDFDEAELAQCIAEAYGSQWSDAAITPLKPLGDDYVLELFNGPTCAFKDVAL
QILPRFMARTTPAGGDAQEKIMILTATSGDTGKAALAGFADAPGTGITVFYPEGKVSEIQ
QLQMTTQAGSNVNVCAVRGNFDDAQSAVKELFSDTELAQELAQEHHVVLSSANSINVGRL
VPQVVYYFSAYVQLVERGAIALGDGVEFCVPTGNFGDVLAGYYAKLLGLPVKHLIVASDK
NNVLFDFLTSGTYNRQRPFYQTISPSMDILVSSNLERMLYYMADKDPRLIQMLMSDLKDW
GAFEVPEPLLAKIRTLFGTGWADESQVREAIHDCWERNRYVIDPHTACGYFVMQRMPRDP
ATPRVLLSTASPYKFPRVVDESLGLDASGSDFDCMDTLAAATGTTAPKSLRDLEHAQPRF
DGAIDIDAMRDAVKDAAAKL
NT seq 1503 nt   +upstreamnt  +downstreamnt
gtgaacaccttccacagcacacgcggggtcaatgatgccatcaacggagaggcgctgagc
gcgaagcaggccatccggcgcggcttggccgaggacggcggcctgttcgtcaccgatgcg
ctgggcgagcggacggttgatgtggcagcgctggtcggcaagtcctatcaggagatcgcc
gcctcagtgctcggcgcattgcttgacgacttcgacgaggccgaactcgcgcagtgcatc
gccgaggcgtacggctcgcagtggtccgatgcggcgatcacgccgctcaagcccttgggc
gacgattacgtgctggaactgttcaacggccccacctgcgccttcaaggacgtggccttg
cagatcttgccgcgcttcatggctcggaccactcctgccggcggcgacgcccaagagaag
atcatgattctgaccgccacttcgggcgacacgggcaaggcggcgctcgccggattcgcc
gacgcgccgggaaccggcatcaccgtcttctaccccgaaggcaaagtcagcgaaatccag
cagctgcagatgaccacgcaggccggctccaatgtgaacgtctgcgcggtgcgcggcaac
ttcgacgatgcgcagagcgccgtcaaggagctgttctccgacactgagctggctcaagaa
ctcgcgcaggagcatcatgtggtgctctcctccgcgaattccatcaacgtcggcaggctc
gtgccgcaggtcgtgtactacttctcggcctacgtgcagctggtcgaacgcggcgcgata
gcgctgggcgacggcgtggagttctgcgtgccgaccggcaacttcggcgacgtgctcgcc
ggatattatgccaagctgctgggcctgccggtcaagcatctcatcgtcgccagcgacaag
aacaacgtcctcttcgacttcctcacgtctggaacatacaaccgccagcggccgttctat
cagacgatttcgccctcgatggacatcctcgtctcctcgaatctcgaacgcatgctctac
tacatggccgacaaggatccgcgactgatccagatgctcatgagcgacctcaaggactgg
ggcgcgttcgaagtgcccgagccgctgctggccaagatccgtacgctgttcggcaccggc
tgggccgatgaaagccaggtacgcgaggcaatccacgactgctgggagcgcaaccgctat
gttatcgacccgcataccgcctgcggttacttcgtcatgcagcgcatgccgcgcgatccg
gccactccccgcgtgctgctgagcaccgccagcccgtacaagttcccccgcgtcgtcgac
gaatcgcttgggcttgacgcctccggcagcgacttcgactgcatggacacgcttgccgcc
gccaccggcaccaccgcgccaaagtccctgcgcgacctagagcacgcccagccccgcttc
gacggtgccatcgacatcgacgccatgcgcgacgccgtcaaggatgctgcagccaaactg
tga

DBGET integrated database retrieval system