Bifidobacterium subtile: BS3272_09140 Help Entry BS3272_09140      CDS       T07068                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism bsue  Bifidobacterium subtile Brite KEGG Orthology (KO) [BR:bsue00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BS3272_09140 Enzymes [BR:bsue01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BS3272_09140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_9 GST_N_3 Glrx-like Thioredoxin DUF6733 GST_N_2 Motif Other DBs NCBI-ProteinID:  QOL36039 LinkDB All DBs Position 2148462..2148731 Genome browser AA seq 89 aa AA seqDB search MTNETPTIEMYGADWCGDCRRAKDALNRFGVGFTWHDIEHEDGAADRAVEVSGQKHIPVV LFTDGSFQVEPSANDLKAKLEALGQFPQE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacgaacgagacaccgaccatcgagatgtacggcgccgactggtgcggggactgccgt cgcgcgaaggacgcgctgaaccgcttcggcgtgggcttcacttggcacgacatcgagcat gaggacggcgcagcggacagggctgtggaagtcagcgggcagaagcacatcccggtcgtg ctgtttacggacggctcattccaagtcgagccgtccgccaatgatctcaaggcgaagctc gaggcactgggccagttcccgcaggaatag

DBGET integrated database retrieval system