Brucella suis bv. 2 Bs143CITA: BSSP1_II0469 Help Entry BSSP1_II0469      CDS       T03367                                  Name (GenBank) Membrane protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bsui  Brucella suis bv. 2 Bs143CITA Pathway bsui00190   Oxidative phosphorylation bsui01100   Metabolic pathways bsui02020   Two-component system Module bsui_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bsui00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BSSP1_II0469  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BSSP1_II0469 Enzymes [BR:bsui01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BSSP1_II0469 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AIB29295 LinkDB All DBs Position II:464960..465115 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system