Brucella suis bv. 2 PT09172: BSPT2_I1429
Help
Entry
BSPT2_I1429 CDS
T03504
Symbol
pcrA
Name
(GenBank) ATP-dependent DNA helicase UvrD/PcrA
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
bsuv
Brucella suis bv. 2 PT09172
Pathway
bsuv03420
Nucleotide excision repair
bsuv03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
bsuv00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
BSPT2_I1429 (pcrA)
03430 Mismatch repair
BSPT2_I1429 (pcrA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
bsuv03400
]
BSPT2_I1429 (pcrA)
Enzymes [BR:
bsuv01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
BSPT2_I1429 (pcrA)
DNA repair and recombination proteins [BR:
bsuv03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
BSPT2_I1429 (pcrA)
MMR (mismatch excision repair)
Other MMR factors
BSPT2_I1429 (pcrA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
UvrD_C_2
AAA_30
PcrA_UvrD_tudor
Viral_helicase1
AAA_11
DUF4420
Motif
Other DBs
NCBI-ProteinID:
AIB24885
LinkDB
All DBs
Position
I:1381776..1384352
Genome browser
AA seq
858 aa
AA seq
DB search
MSDFPDDMPFFGDDDAPAGRAPAPGSIAARAMAARNQQHGEPDYLKGLNPEQKQAVLTTE
GPVLVLAGAGTGKTRVLTTRIAHILSTGLAYPSQILAVTFTNKAAREMKERIGHLVGGAV
EGMPWLGTFHSIGVKLLRRHAELVNLTSSFTILDTDDVIRLIKQLIQAEGLDDKRWPART
FANMIDGWKNKGFSPADIPEGDARSFGNGRGRELYQAYQERLRTLNACDFGDLLLHPIRI
FRNHPDILREYHAKFRYILVDEYQDTNTAQYLWLHLLAQRPKSRTTAPTQAGGSPVQPAR
ASEGPCGAGERSELGVSEDKVNLCCVGDDDQSIYGWRGAEVDNILRFEKDFPGAVVIKLE
RNYRSTAHILGTAAHLIAHNEGRLGKTLFTEAPNPDDPRVKVHAAWDSEEEARAVGEAIE
QAQRQGHLLNNMAILVRASFQMREFEDRFVTLGLNYRVIGGPRFYERLEIRDAMAYLRVV
AQPADDLALERIINTPKRGLGEAAIRQIHDYARARDISMFAAACDLIETEELKPKPRSAL
REVVENFLRWQSLIDTTPHTELAETILDESGYTAMWQNDKSAEAPGRLENLKELIRSMEE
YESLRGFLEHVALVMDAEQNEDMDAVNIMTLHSAKGLEFETVFLPGWEEGLFPHQRALDE
GGRSGLEEERRLAYVGVTRAKKNLHIWFVSNRRIHGMWQSTIPSRFLEELPEAHVEVAEL
EGNYGGYGGGYGQSRFDKADPFQNSYSTPGWQRAQQNRSDATRNNWGSRSGSRVERIGYG
ETDSGFGAGRGSVKGRTIEGELVAKSVADKPSAFKLGDRVFHIKFGNGTISLIDGNKLTI
NFDKAGQKRVLDSFVQPI
NT seq
2577 nt
NT seq
+upstream
nt +downstream
nt
atgtccgattttcccgacgatatgccgtttttcggcgatgacgacgctccggctggccgc
gcgcccgctcccggcagcattgccgcacgcgccatggccgcacgcaaccagcagcatggc
gagcccgattacctcaagggcctgaacccggagcagaaacaggcggtgctcaccaccgag
ggcccggttctggtgctggcgggtgctggcaccggcaagacgcgcgtgctcaccacgcgc
attgcacatattctttcgaccggccttgcctatccgagccagattttggccgtgaccttc
accaacaaggccgcgcgcgaaatgaaggagcgtatcggccatctggtcggcggtgctgtt
gaaggcatgccctggcttggcacattccactccatcggcgtcaagcttttgcgccgccac
gccgaactggtcaatcttacctccagcttcaccatcctcgatacggacgatgtgatccgg
ctcatcaagcagcttattcaggccgaaggactggatgacaaacgctggcctgcccgcacc
ttcgccaatatgatcgacggctggaagaataagggtttcagtcccgccgatattcccgaa
ggggatgcgcgctcgttcggcaacgggcggggccgtgagctttatcaggcctatcaggaa
cggttgcgcacactgaacgcctgtgattttggcgatcttctgctgcatccgatccgcatc
ttccgcaaccacccggatatcctgcgcgaatatcatgcaaaattccgctacattctggtg
gacgaatatcaggacaccaacaccgcacaatatctctggctgcatctgctagcacagcga
ccaaaatcacgaacgacagcgccaacgcaggccggaggctcgccagtacagcccgctagg
gcgtccgaaggcccctgcggagccggtgagcgcagcgaactcggcgtgagcgaagacaaa
gtaaacttgtgttgtgtgggcgatgacgaccagtcgatctatggctggcgcggagcggaa
gtggacaatatcttgcgctttgagaaggactttccgggcgcggtcgttatcaagcttgag
cgcaattatcgctccacggcgcatattctgggcactgccgcgcatctgatcgcgcataat
gaaggccgtttgggcaagacgcttttcaccgaggcacccaatccggatgacccgcgcgtc
aaggtccatgcggcctgggactcggaagaggaagcgcgtgcggttggcgaagccatcgag
caggcgcagcgtcaggggcaccttctcaacaatatggcgatccttgtgcgcgcctccttc
cagatgcgtgagtttgaagaccgttttgtcacgctcggcctcaattatcgcgtcataggc
ggcccgcgcttctatgagcgcctcgaaattcgcgatgccatggcatatctgcgcgtcgtc
gcgcaacccgccgacgatctggcgctggagcgcatcatcaacacgccaaagcgcggcctt
ggcgaagcagccatccgccagattcatgactatgcgcgcgcgcgcgacatttccatgttc
gctgcggcctgcgacctcatagaaaccgaggagctgaaacccaagccacgctctgccctg
cgtgaggtggtggagaatttcctgcgctggcagtcgctgatcgacaccacgccgcatacg
gaactggcggaaaccattcttgatgaatccggctacaccgccatgtggcagaacgacaaa
tcagcggaagcgccgggccggcttgaaaacctcaaggaactgatccgttccatggaggaa
tatgaaagcctgcgtggtttcctcgaacatgtcgcgctcgtcatggatgccgagcagaat
gaggatatggatgccgtcaacatcatgacgctgcattcggccaaggggctggagtttgaa
accgtcttccttcccggctgggaggaaggcctgtttccacaccagcgcgcgcttgatgaa
ggcggacgttcggggctggaggaagagcgccgcctcgcctatgtcggcgtcacccgcgcc
aagaaaaacctgcatatctggttcgtgtccaaccgccgcatccacggcatgtggcaatcg
accatcccgtcgcgctttctggaagagcttcccgaagcacatgtggaggtggccgaactg
gaaggtaattatggtggttatggcggcggctatggacagtcccgtttcgacaaggccgac
cccttccagaactcctattccacacccggctggcagcgtgcgcagcagaaccgttcggat
gcaacgcgcaacaactggggttcgcgctcgggcagccgcgtggagcgcattggctatggc
gagaccgattccggcttcggtgcggggcgtggatcggtaaaaggccgcacgattgaaggc
gaactggtggcaaaatcagtggccgacaaaccatcggccttcaagcttggcgaccgcgta
ttccatatcaaattcggaaacggcacgatttcgcttatcgacggcaacaagctgacgatc
aatttcgacaaggccggacaaaagcgcgttctcgatagtttcgtccagccgatctaa
DBGET
integrated database retrieval system