KEGG   Brucella suis VBI22: BSVBI22_B0056
Entry
BSVBI22_B0056     CDS       T01706                                 
Name
(GenBank) amino acid permease family protein
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
bsv  Brucella suis VBI22
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsv02000]
    BSVBI22_B0056
Transporters [BR:bsv02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSVBI22_B0056
SSDB
Motif
Pfam: AA_permease AA_permease_2 PrgI
Other DBs
NCBI-ProteinID: AEU07218
LinkDB
Position
II:complement(53090..54493)
AA seq 467 aa
MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMGSGKAVSLAGPSILLIY
AITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFFTGWTYWLCWIVTAVAEVV
AVSGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEIEFWFALIKIITIIGLIITGI
YMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGFQISVFAFVGIELVGTAAAEAEN
PMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQVDPNSSPFVAMFSLAGIGIAAHFIN
FVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKAFSKLSNRKVPVHALIFSCIFLLSSVV
LLYAGQSMIQVFTLVTTISALLFIFIWSIILVSYLQYRRKHPERHEKSTFKMPGRRASVV
MVFIFFAFVLWALTQEPDTLAAMKVTPLWFVLLGIAYRVMKLKQKQS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaatactatatcaaagccttccgttgatttgcaccgggaggaggaacctcatcttgca
cgtaatctatccaatcgacacctccagctgatcgccatcggcggcacgatcggcaccggc
cttttcatggggtcgggcaaagccgtttcgctggcggggccttcgatcctgctcatctat
gcgatcaccggcttcatgctgtttttcgtcatgcgcgcgctgggcgaaattctgctttcc
aacctgcaatatcgctccttcgcggacttcgcgggtgactatctggggccatgcgcacaa
tttttcaccggctggacctactggctatgctggatcgtgacggccgtggccgaagtcgtg
gccgtttccggctatgtctcattctggtttcctcatctggcgccgtggatcccggccctc
ggcctcatcacaatactgctgatactgaatctgccgaccgtgcgcaattttggtgaaatc
gaattctggttcgctctcatcaaaattatcaccattatcgggctgattattactggcata
tacatgctcatgacgggctttgtcttgcccaatggcacccaggcatcaattgcccatctg
tggaaccatggcgggttcttccccaatggttctcttggctttatcgccgggttccagata
tcggtttttgctttcgtcggtatcgaactcgtgggcacggctgctgcggaggccgaaaac
ccgatgcgaaacctgccaaaggcgatcaataatatcccgatccgtatcgttcttttttat
attggcgcgctgtttgtcatcatcaccgtcactccgtggaatcaggtggacccgaattca
agccccttcgtggccatgttctcgctcgccggtatcggcatagcagcccatttcataaat
tttgtcgttctgacttcggcatcgtcgagttcaaattccggcatctactcgacctcgcgc
atggtctacggccttgccactgtcgggcttgcaccgaaagccttcagtaaactgagcaat
cgcaaggtgccggtccacgcgctaatcttctcttgcatattcctgctgtcgagcgtggtt
ctgctttatgcaggccagagcatgatccaggtcttcacactcgtcacgacgatttcggcg
ctcctgttcattttcatctggtcgattatcctggtgtcttacctgcaatatcgccgcaag
caccccgaacggcatgaaaaatccaccttcaagatgcccggtagacgtgcatctgtcgtt
atggtcttcattttctttgccttcgtcctttgggcgctgacacaggaaccggatacgtta
gccgcgatgaaagtcacgccattgtggttcgtgcttctgggcattgcctatagggtcatg
aaattaaagcaaaagcagagctaa

DBGET integrated database retrieval system