Brucella suis ZW043: IY71_04440 Help Entry IY71_04440        CDS       T03426                                  Name (GenBank) membrane protein   KO K03210   preprotein translocase subunit YajC Organism bsw  Brucella suis ZW043 Pathway bsw02024   Quorum sensing bsw03060   Protein export bsw03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:bsw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     IY71_04440  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     IY71_04440  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IY71_04440  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bsw02044]     IY71_04440 Secretion system [BR:bsw02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    IY71_04440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC Orf78 Motif Other DBs NCBI-ProteinID:  AIN84146 UniProt:  A0AAI8E7Z8 LinkDB All DBs Position 1:880271..880612 Genome browser AA seq 113 aa AA seqDB search MFVTPAFAQASGSVVGPDMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDT VVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPVADNKNK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgttcgtaacaccggctttcgctcaagcatccggcagcgttgttggaccagatatgctc atgagcatcctgccgttcatcctgatcttcgtcatcatgtactttctcatcatccgcccg cagcggacccagatgaagaagcgtcaggaaatgctgaactccgtgcgtcgtggcgatacg gtcgtgacgggtggcggcatcgtcggcaaggttctcaaggttgtcgatgacaacgaactc gaactcgaaattgccgatggcgttcgtattcgcgttgtgcgtgccaccttgatggatgtg cgcgtgaagggcgaacctgtcgccgacaacaagaacaaataa

DBGET integrated database retrieval system